PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011086808.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 470aa    MW: 51201.4 Da    PI: 8.9251
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011086808.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.13.4e-40183260178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +C vegC+ dls+akeyhr+h+vC+ hsk+p+v+v g+e+rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  XP_011086808.1 183 RCVVEGCNIDLSTAKEYHRKHRVCDSHSKCPKVVVGGIERRFCQQCSRFHSLSEFDEKKRSCRRRLSDHNARRRKPQQ 260
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-33180245IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.146181258IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.06E-38182263IPR004333Transcription factor, SBP-box
PfamPF031101.8E-30184257IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MSHFAEMEWN SKWDWENFLG FGSKAMESPK KLQLADWTIV DDGQIDAGSF NLSAGGGNSG  60
ASDSDGGHVS SAKSSISAST DSSTKDGMQN ANFSLITFQG FSGNFSKKKE MKGAHVSGTS  120
PPLDASIGSV EPLIGLKLGK RTYFENSGAG GNVKTAPLPV MPTPSATPLK KTKSLGQNLP  180
IPRCVVEGCN IDLSTAKEYH RKHRVCDSHS KCPKVVVGGI ERRFCQQCSR FHSLSEFDEK  240
KRSCRRRLSD HNARRRKPQQ EAIQFNSTRL SSPFYEGRPQ ISFLLNDAPV INSKNPANST  300
WNSTSNSEFT LTKGYPLKSN GDGGTDEQMH MRGVKLPHVI NMHGTAANGV FASKSSMPTI  360
LNPGSKGPLT CSHLDAAPEY RRALSLLSSN SWGSCGPESM PVHDQMHEQG TNVAQPMMHA  420
TPEGVPLSSS QFWLTGHQPT QPRVATNSNF QEVQLLKTPY EPDFYSNMLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-281842571184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1239256KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086805.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086806.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086807.10.0PREDICTED: squamosa promoter-binding-like protein 12
RefseqXP_011086808.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A022R3T10.0A0A022R3T1_ERYGU; Uncharacterized protein
TrEMBLA0A075FJ540.0A0A075FJ54_SALMI; SQUAM
STRINGVIT_01s0010g03710.t011e-148(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-66squamosa promoter binding protein-like 2